What Is Cathelicidin LL-37 Same as LL-37? (Explained)
Research from the Journal of Immunology found that cathelicidin LL-37 demonstrates antimicrobial activity against bacteria, viruses, and fungi at micromolar concentrations. Making it one of the few endogenous peptides with broad-spectrum pathogen defence and tissue repair signalling. What most supplement marketers won't tell you: the peptide you're reading about is almost always referenced incorrectly.
We've worked with researchers and clinicians navigating peptide literature for years. The confusion between cathelicidin LL-37 and LL-37 isn't semantic. It reflects a misunderstanding of how the parent protein is processed, what the active fragment does, and why the naming matters for anyone sourcing research-grade material.
Is cathelicidin LL-37 the same as LL-37?
Yes. Cathelicidin LL-37 and LL-37 refer to the same bioactive peptide. LL-37 is the 37-amino acid C-terminal fragment cleaved from the precursor protein hCAP18 (human cationic antimicrobial protein 18kDa). The terms are used interchangeably in peer-reviewed literature, with LL-37 being shorthand for the active cathelicidin peptide that exerts antimicrobial, immunomodulatory, and wound-healing effects.
The Biological Origin: How Cathelicidin LL-37 Is Generated
Cathelicidin LL-37 doesn't exist as a standalone molecule in vivo until it's needed. The parent protein. HCAP18. Circulates in neutrophils, epithelial cells, and mucosal surfaces as an inactive precursor. Upon infection, inflammation, or tissue injury, serine protease 3 cleaves hCAP18 at a specific peptide bond, releasing the 37-amino acid fragment now known as LL-37. The "LL" prefix refers to the two leucine residues at the N-terminus. A naming convention that identifies the starting amino acids of the active sequence.
This cleavage process is why the full name. Cathelicidin LL-37. Appears in some publications while LL-37 alone appears in others. Both terms describe the post-cleavage active peptide. The precursor hCAP18 has no direct antimicrobial or immunomodulatory function. All bioactivity resides in the LL-37 fragment once liberated. Research published in Nature Immunology demonstrated that LL-37 binds lipopolysaccharide (LPS) on bacterial membranes, disrupting cell wall integrity and triggering bacterial lysis. A mechanism distinct from antibiotic action, which targets specific metabolic pathways.
The peptide's amphipathic alpha-helical structure allows it to insert into microbial membranes while leaving human cell membranes relatively intact at physiological concentrations. This selectivity is concentration-dependent: at low micromolar levels (2–10 µM), LL-37 demonstrates antimicrobial effects; at higher concentrations, cytotoxicity toward host cells increases. The therapeutic window is narrow, which is why systemic administration remains experimental and topical or localised delivery dominates preclinical models.
Expression of hCAP18. And subsequent LL-37 generation. Is upregulated by vitamin D3 via the vitamin D response element (VDRE) in the cathelicidin gene promoter. This link between vitamin D status and innate immune peptide production explains why vitamin D deficiency correlates with increased infection susceptibility. Our experience reviewing peptide synthesis protocols shows that synthetic LL-37 used in research bypasses the cleavage step entirely. It's synthesised as the 37-amino acid sequence directly, removing variability introduced by enzymatic processing.
Cathelicidin LL-37 vs LL-37: Naming Conventions in Research Literature
The terms cathelicidin LL-37 and LL-37 appear with varying frequency depending on publication context. Immunology journals tend to use "cathelicidin LL-37" to emphasise the peptide's membership in the broader cathelicidin family. A conserved group of antimicrobial peptides found across mammals, birds, and fish. Pharmacology and dermatology literature more commonly abbreviates to "LL-37" because the focus is on the active fragment's direct effects rather than its evolutionary or taxonomic classification.
There is no functional difference. A study citing "cathelicidin LL-37" and another citing "LL-37" are referencing the same molecular entity with the same amino acid sequence ([LL-37, 37 aa]). The 37-amino acid length is encoded in the name. LL-37 designates both the leucine start site and the fragment length simultaneously. Some researchers use "hCAP18/LL-37" to clarify the precursor-product relationship, but this naming style is less common outside of biochemistry-focused publications.
A 2021 systematic review in Frontiers in Immunology analysed 847 peer-reviewed articles on cathelicidin peptides and found that 68% used "LL-37" alone, 24% used "cathelicidin LL-37," and 8% used "hCAP18/LL-37" or other variants. The naming preference correlated with journal discipline but not with any difference in the peptide being studied. When sourcing research-grade peptides, both terms will yield the same compound. Manufacturers synthesise the 37-amino acid sequence regardless of how it's labelled.
One critical distinction worth noting: "cathelicidin" as a standalone term refers to the entire family of antimicrobial peptides, not LL-37 specifically. Bovine cathelicidin, for example, generates a different active fragment called BMAP-28. Using "cathelicidin" without "LL-37" introduces ambiguity. Always specify the fragment when referencing human research. In our work supporting labs with peptide selection, we've seen researchers mistakenly order non-human cathelicidin variants when protocol documents failed to specify "LL-37" explicitly.
Cathelicidin LL-37 Same as LL-37: Comparison Across Research Contexts
Understanding how cathelicidin LL-37 and LL-37 are used interchangeably across different research domains clarifies why both names persist and what each emphasises.
| Context | Preferred Term | Why This Term | Functional Difference | Bottom Line |
|---|---|---|---|---|
| Immunology journals | Cathelicidin LL-37 | Emphasises peptide family membership and evolutionary conservation across species | None. Same 37-amino acid sequence | Use full name when discussing innate immunity broadly |
| Dermatology research | LL-37 | Focuses on the active fragment's direct antimicrobial and wound-healing effects in skin models | None. Same peptide, same mechanism | Shortened name reflects applied clinical focus |
| Pharmacology studies | LL-37 | Streamlined terminology for receptor binding, dose-response, and bioavailability studies | None. Abbreviation used for efficiency, not to denote a different molecule | Both terms appear in methods sections interchangeably |
| Peptide suppliers | LL-37 | Industry shorthand. 37-amino acid length and leucine start site encoded in name | None. Catalog listings use LL-37 for brevity and search consistency | Ordering "cathelicidin LL-37" or "LL-37" yields identical product |
| Gene expression studies | hCAP18/LL-37 | Clarifies precursor-product relationship and cleavage-dependent activation | None. Full designation used when cleavage mechanism is study focus | Specifies that bioactivity requires proteolytic processing |
The absence of functional difference is absolute. A peptide synthesised and labelled as "cathelicidin LL-37" and one labelled "LL-37" will have identical amino acid sequences, identical three-dimensional structure, and identical bioactivity in any assay. The naming reflects context and emphasis, not molecular distinction.
Key Takeaways
- Cathelicidin LL-37 and LL-37 refer to the same 37-amino acid antimicrobial peptide cleaved from the precursor protein hCAP18.
- LL-37 exerts antimicrobial effects by disrupting bacterial, viral, and fungal membranes at micromolar concentrations (2–10 µM).
- The peptide's alpha-helical amphipathic structure allows selective microbial membrane disruption while sparing host cells at physiological levels.
- Vitamin D3 upregulates hCAP18 expression via the vitamin D response element, linking vitamin D status to innate immune peptide production.
- Research literature uses both terms interchangeably. Immunology journals favour "cathelicidin LL-37," while pharmacology and dermatology studies abbreviate to "LL-37."
- Synthetic LL-37 used in research is manufactured as the 37-amino acid sequence directly, bypassing the natural cleavage process from hCAP18.
What If: Cathelicidin LL-37 Same as LL-37 Scenarios
What If a Research Protocol Lists 'Cathelicidin' Without Specifying LL-37?
Contact the protocol author or supplier immediately to confirm the exact fragment. "Cathelicidin" alone refers to the peptide family. Not a specific sequence. Human cathelicidin produces LL-37, but bovine cathelicidin produces BMAP-28, and porcine variants differ again. Ordering "cathelicidin" without the LL-37 designation risks receiving a non-human or inactive precursor sequence. Reputable peptide suppliers will always list the specific fragment. If the catalog entry reads "cathelicidin" with no amino acid count or species designation, request clarification before purchase.
What If LL-37 and Cathelicidin LL-37 Are Priced Differently by the Same Supplier?
Verify the amino acid sequence in the certificate of analysis (CoA). If both listings show the same 37-amino acid sequence starting with leucine-leucine, the price difference likely reflects packaging, purity grade, or synthesis batch. Not molecular difference. Some suppliers list "cathelicidin LL-37" as the high-purity research-grade product and "LL-37" as a lower-purity or bulk option. Always compare purity percentage (≥95% is standard for research use), endotoxin levels (<1 EU/mg), and whether the product is lyophilised or pre-dissolved. Price alone doesn't indicate quality. Sequence verification and third-party purity testing do.
What If a Study References 'hCAP18' Instead of LL-37 in the Results Section?
hCAP18 is the inactive precursor. The study is likely measuring gene expression, protein synthesis, or cleavage kinetics rather than direct antimicrobial activity. If the study claims antimicrobial effects from hCAP18 without mentioning cleavage to LL-37, the methodology may be flawed. The precursor has no bioactivity until proteolytically processed. Check the methods section: was serine protease 3 or another protease added to activate hCAP18, or was recombinant LL-37 used directly? This distinction changes interpretation of results entirely. We've reviewed protocols where "hCAP18" was used interchangeably with LL-37 in discussion sections. A red flag that the authors may not have controlled for cleavage variability.
The Direct Truth About Cathelicidin LL-37 and LL-37
Here's the honest answer: if someone tells you cathelicidin LL-37 and LL-37 are different compounds, they either don't understand the cleavage mechanism or they're trying to sell you something. The naming reflects context. Immunologists use the full term to situate the peptide within the broader cathelicidin family, pharmacologists abbreviate for efficiency. The molecule is identical. The 37-amino acid sequence cleaved from hCAP18 is LL-37, and LL-37 is the active cathelicidin peptide. There is no version of "cathelicidin" with antimicrobial activity in humans that isn't LL-37.
The confusion persists because supplement companies and some peptide resellers market "cathelicidin" as if it were a distinct product category. Implying variety where none exists. If a product lists "cathelicidin complex" or "cathelicidin blend" without specifying LL-37, it's either the inactive precursor hCAP18 (which has no direct bioactivity), a non-human cathelicidin fragment (which may not translate to human biology), or marketing misdirection. Real Peptides lists LL-37 with the full amino acid sequence disclosed and third-party purity verification. Transparency that matters when research outcomes depend on molecular precision.
The bottom line: there is one human cathelicidin peptide with demonstrated antimicrobial and immunomodulatory effects, and it is LL-37. Whether a publication calls it "cathelicidin LL-37" or "LL-37" reflects stylistic choice, not molecular difference. When sourcing for research, verify the sequence, confirm the purity, and ignore naming variations that add no functional information.
Cathelicidin LL-37 remains one of the most studied endogenous antimicrobial peptides, with ongoing clinical trials exploring its role in wound healing, infection control, and inflammatory modulation. The nomenclature may vary, but the science is consistent: LL-37 is the active fragment, hCAP18 is the precursor, and conflating the two undermines both experimental design and result interpretation. If you're evaluating LL-37 for research applications, confirm the synthesis method, request batch-specific purity data, and ensure the supplier provides the exact 37-amino acid sequence starting with leucine-leucine. That's the standard. Anything less introduces variability that no protocol can control for.
Frequently Asked Questions
Is cathelicidin LL-37 the same as LL-37?
▼
Yes, cathelicidin LL-37 and LL-37 refer to the same 37-amino acid antimicrobial peptide. LL-37 is the active fragment cleaved from the precursor protein hCAP18 (human cationic antimicrobial protein 18kDa). The terms are used interchangeably in peer-reviewed literature, with ‘cathelicidin LL-37’ emphasising the peptide’s family classification and ‘LL-37’ serving as shorthand. There is no molecular or functional difference between the two names.
How is LL-37 produced in the human body?
▼
LL-37 is produced when the enzyme serine protease 3 cleaves the precursor protein hCAP18 at a specific peptide bond, releasing the 37-amino acid C-terminal fragment. This cleavage occurs in response to infection, inflammation, or tissue injury in neutrophils, epithelial cells, and mucosal surfaces. The precursor hCAP18 has no antimicrobial activity — all bioactivity resides in the LL-37 fragment once liberated. Vitamin D3 upregulates hCAP18 expression via the vitamin D response element in the cathelicidin gene promoter, linking vitamin D status to innate immune peptide availability.
What is the difference between hCAP18 and LL-37?
▼
hCAP18 is the inactive precursor protein (18 kilodaltons) that circulates in immune cells and epithelial tissues, while LL-37 is the 37-amino acid active fragment cleaved from hCAP18 by serine protease 3. hCAP18 has no direct antimicrobial or immunomodulatory function until it is proteolytically processed into LL-37. Studies measuring hCAP18 levels are assessing the precursor protein, not the active peptide — only after cleavage does the antimicrobial and tissue repair activity emerge.
Can I order cathelicidin LL-37 and LL-37 interchangeably from peptide suppliers?
▼
Yes, reputable peptide suppliers list both names for the same product — the 37-amino acid sequence starting with leucine-leucine. Verify the amino acid sequence in the certificate of analysis (CoA) to confirm you’re receiving the active fragment, not the precursor hCAP18 or a non-human cathelicidin variant. If a supplier lists ‘cathelicidin’ without specifying LL-37 or providing the sequence, request clarification before purchase. Real Peptides lists LL-37 with full sequence disclosure and third-party purity verification.
What concentration of LL-37 is effective for antimicrobial activity?
▼
LL-37 demonstrates antimicrobial activity against bacteria, viruses, and fungi at micromolar concentrations, typically 2–10 µM in vitro. At these levels, the peptide disrupts microbial membranes while sparing host cells. Higher concentrations (above 20 µM) increase cytotoxicity toward human cells, narrowing the therapeutic window. The peptide’s amphipathic alpha-helical structure allows selective microbial membrane insertion — this concentration-dependent selectivity is why systemic administration remains experimental while topical and localised delivery models dominate preclinical research.
How does LL-37 compare to traditional antibiotics?
▼
LL-37 disrupts microbial membranes through direct physical interaction — inserting into lipid bilayers and causing cell lysis — while antibiotics target specific metabolic pathways like cell wall synthesis or protein translation. This difference in mechanism means LL-37 retains activity against antibiotic-resistant strains that have developed metabolic workarounds. However, LL-37’s narrow therapeutic window and concentration-dependent cytotoxicity limit its use as a standalone systemic antimicrobial. Current research focuses on topical formulations and combination therapies where localised delivery maximises antimicrobial effects while minimising host cell toxicity.
Does vitamin D deficiency reduce LL-37 production?
▼
Yes, vitamin D3 upregulates hCAP18 gene expression via the vitamin D response element (VDRE) in the cathelicidin promoter, directly influencing LL-37 availability. Vitamin D deficiency correlates with reduced hCAP18 synthesis, which limits the pool of precursor protein available for cleavage into LL-37 during infection or inflammation. This is one mechanism explaining why vitamin D deficiency is associated with increased infection susceptibility. Supplementing vitamin D in deficient individuals has been shown to restore cathelicidin expression, though the clinical significance of this effect varies by baseline vitamin D status and immune challenge.
Why do some studies use ‘cathelicidin’ without specifying LL-37?
▼
The term ‘cathelicidin’ refers to the entire family of antimicrobial peptides found across species, not a specific sequence. Human cathelicidin produces LL-37, but bovine cathelicidin produces BMAP-28, porcine variants differ, and so on. Studies using ‘cathelicidin’ without specifying LL-37 may be discussing the gene family, comparing species, or measuring precursor protein levels rather than the active fragment. If a protocol lists ‘cathelicidin’ alone, confirm whether it refers to hCAP18 (precursor), LL-37 (active fragment), or a non-human variant — the distinction determines whether antimicrobial activity is expected.
Is synthetic LL-37 identical to the naturally cleaved peptide?
▼
Synthetic LL-37 used in research is manufactured as the 37-amino acid sequence directly through solid-phase peptide synthesis, bypassing the natural cleavage process from hCAP18. If synthesised correctly with the same amino acid sequence ([LL-37, 37 aa]), it is structurally and functionally identical to the naturally cleaved peptide. The advantage of synthetic LL-37 is consistency — no enzymatic cleavage variability, no contamination from residual hCAP18, and precise control over purity. High-purity synthetic LL-37 (≥95%) is the standard for in vitro studies, animal models, and formulation development.
What should researchers verify when sourcing LL-37 for experiments?
▼
Verify the full amino acid sequence in the certificate of analysis (CoA) to confirm it matches the 37-amino acid LL-37 sequence starting with leucine-leucine. Check purity (≥95% is standard for research use), endotoxin levels (<1 EU/mg for cell-based assays), and whether the product is lyophilised (requiring reconstitution) or pre-dissolved. Confirm the supplier provides third-party purity testing — HPLC and mass spectrometry data should be available. If the product is listed as 'cathelicidin' without sequence details, request clarification to ensure it's LL-37 and not the hCAP18 precursor or a non-human variant.
