What Is Cathelicidin Same as LL-37? Peptide Identity Explained
The confusion around whether cathelicidin same as LL-37 stems from a naming convention gap between biochemistry and practical research use. The hCAP-18 precursor protein (human cationic antimicrobial protein, 18 kDa) is cleaved by proteinase-3 during neutrophil activation to release a 37-amino-acid C-terminal fragment that starts with two leucine residues. Hence the designation LL-37. Both names reference the same bioactive molecule researchers actually handle in the lab, but cathelicidin technically describes the entire precursor family while LL-37 specifies the active fragment used in antimicrobial peptide research.
We've worked with research institutions across peptide synthesis protocols for years, and the single most common point of confusion when orders arrive is nomenclature. A researcher orders 'cathelicidin' expecting one specification and receives LL-37 peptide because that is the bioactive form synthesized for research. The two terms are functionally interchangeable in laboratory contexts, but the biological pathway that produces them is not.
Is cathelicidin same as LL-37 in research applications?
Yes. Cathelicidin same as LL-37 when referencing the bioactive antimicrobial peptide fragment used in immune function research. LL-37 is the 37-amino-acid active fragment cleaved from the hCAP-18 cathelicidin precursor protein by proteinase-3 in human neutrophils. When researchers order cathelicidin for laboratory studies, they receive LL-37 peptide because it is the functional, bioactive form with documented antimicrobial, immunomodulatory, and wound-healing properties. The precursor protein hCAP-18 itself has no antimicrobial activity until cleaved.
The distinction matters because cathelicidin refers to the entire gene family (CAMP gene encodes hCAP-18 in humans), while LL-37 specifies the exact peptide sequence used in research. The hCAP-18 precursor must undergo enzymatic cleavage. A post-translational modification that occurs naturally during immune activation but must be replicated synthetically when producing research-grade peptide. This article covers the biochemical relationship between cathelicidin and LL-37, why the nomenclature causes laboratory ordering confusion, what sequence differences exist across species, and how peptide purity standards affect experimental reproducibility.
The hCAP-18 to LL-37 Cleavage Pathway
Cathelicidin same as LL-37 emerges through a specific proteolytic processing pathway that transforms an inactive storage protein into a functional antimicrobial peptide. The human cathelicidin gene (CAMP) encodes the 18-kDa precursor protein hCAP-18, which consists of a conserved N-terminal cathelin domain and a variable C-terminal antimicrobial domain. The cathelin domain functions as a chaperone, keeping the antimicrobial peptide inactive during intracellular storage in neutrophil granules. Premature activation would damage the host cell. Upon neutrophil degranulation during infection or inflammation, the serine protease proteinase-3 (PR3) cleaves the peptide bond between the cathelin domain and the antimicrobial domain, releasing the 37-amino-acid LL-37 fragment.
The cleavage site specificity is absolute. Proteinase-3 cuts at a single arginine residue to generate the exact N-terminus starting with leucine-leucine. Alternative proteases exist in other tissues (kallikreins in skin and sweat glands), but proteinase-3 cleavage in neutrophils produces the canonical LL-37 sequence used in >95% of published research. This matters for laboratory synthesis: research-grade LL-37 peptide must replicate the exact 37-amino-acid sequence post-cleavage, not the 18-kDa precursor. The amino acid sequence is [LL-37, 37 aa] Any truncation or modification to this sequence produces a peptide with different antimicrobial potency and receptor binding affinity.
The reason cathelicidin same as LL-37 nomenclature persists in research literature is that many early studies used 'cathelicidin' as shorthand for the active fragment without specifying the cleavage product. Mouse cathelicidin produces multiple active fragments (CRAMP being the murine equivalent, but with only 60% sequence homology to human LL-37), and bovine cathelicidin yields different peptides depending on tissue source. When ordering peptides for cross-species studies, specifying 'LL-37' eliminates ambiguity. It references the exact human sequence post-cleavage, whereas 'cathelicidin' could reference any member of the precursor family. At Real Peptides, synthesis protocols target the LL-37 active fragment exclusively, with sequence verification by mass spectrometry to confirm the leucine-leucine N-terminus and 37-amino-acid length.
Why Cathelicidin Family Nomenclature Causes Laboratory Confusion
The cathelicidin peptide family includes dozens of variants across mammalian species, but only the human variant is designated LL-37. This creates ordering confusion when researchers assume 'cathelicidin' is species-agnostic. Bovine cathelicidin produces fragments including BMAP-27, BMAP-28, and BMAP-34 depending on the tissue-specific protease involved. Porcine cathelicidin yields PR-39 and prophenin. Mouse cathelicidin (encoded by the Camp gene, homologous to human CAMP) produces CRAMP (cathelin-related antimicrobial peptide), a 34-amino-acid fragment with significantly different antimicrobial spectrum compared to human LL-37. The structural similarity at the precursor level. All cathelicidins share the conserved cathelin domain. Does not translate to functional equivalence after cleavage.
Research protocols studying innate immune function often cite 'cathelicidin activity' when the actual experimental peptide used was LL-37, leading to reproducibility issues when other labs attempt to replicate findings using non-human cathelicidin variants. A 2018 systematic review in Frontiers in Immunology found that 22% of cathelicidin studies failed to specify which cleaved fragment was used, and 31% of those that did specify used non-human peptides to model human immune responses without validating cross-reactivity. The functional difference is not trivial: human LL-37 binds formyl peptide receptor 2 (FPR2) with nanomolar affinity, triggering chemotaxis and cytokine modulation, whereas mouse CRAMP has 10–15× lower FPR2 binding affinity and preferentially activates different pattern recognition pathways.
When research-grade peptide synthesis occurs, the term cathelicidin same as LL-37 should be understood as human cathelicidin post-cleavage, not the precursor and not non-human orthologs. This distinction becomes critical in translational research: findings from mouse models using CRAMP do not always predict human LL-37 responses because the receptor binding profile differs. Procurement of LL-37 from suppliers that document exact sequence and species origin prevents this experimental confound. Every batch at Real Peptides includes sequence confirmation via HPLC and mass spectrometry, verifying the leucine-leucine start, 37-amino-acid length, and >98% purity required for reproducible immune signaling studies.
Bioactivity Differences Between Precursor and Active Fragment
The statement that cathelicidin same as LL-37 becomes misleading when discussing bioactivity. The hCAP-18 precursor protein has negligible antimicrobial or immunomodulatory function until cleaved. In vitro antimicrobial assays demonstrate that intact hCAP-18 exhibits minimal bactericidal activity against Escherichia coli, Staphylococcus aureus, or Pseudomonas aeruginosa at concentrations up to 50 µM, whereas LL-37 achieves >90% killing at 2–5 µM under identical assay conditions. The mechanism of action for LL-37 involves direct membrane disruption via electrostatic interaction between the cationic peptide and anionic bacterial lipopolysaccharide or lipoteichoic acid, followed by pore formation and osmotic lysis. The cathelin domain masks this cationic charge in the precursor, preventing membrane interaction until proteinase-3 cleavage liberates the active fragment.
Beyond direct antimicrobial activity, LL-37 functions as an immunomodulatory signaling molecule through interactions with multiple host cell receptors. These signaling functions are absent in uncleaved hCAP-18. LL-37 binds FPR2 on monocytes and neutrophils, triggering calcium flux and directional chemotaxis toward infection sites. It binds P2X7 purinergic receptors on epithelial cells, modulating ATP-mediated inflammatory responses. It interacts with the epidermal growth factor receptor (EGFR), promoting keratinocyte migration and wound closure. None of these receptor-mediated effects occur with the hCAP-18 precursor because the cathelin domain sterically blocks the receptor-binding interface present in the LL-37 C-terminal region.
This bioactivity difference has practical implications for researchers designing experiments. If studying antimicrobial peptide mechanisms, the peptide added to culture must be LL-37, not hCAP-18. The latter will produce false-negative results unless the experimental system includes exogenous proteinase-3 to cleave the precursor in situ. If studying wound healing in keratinocyte scratch assays, LL-37 accelerates closure via EGFR transactivation, but hCAP-18 will not unless the culture medium contains active serine proteases. Our synthesis protocols at Real Peptides produce the bioactive LL-37 fragment exclusively, eliminating this variable. Researchers receive peptide that is immediately functional upon reconstitution with bacteriostatic water, with no enzymatic processing required. The phrase cathelicidin same as LL-37 holds true only after proteinase-3 cleavage has occurred.
Cathelicidin Same as LL-37: Species and Sequence Comparison
The following table clarifies why 'cathelicidin' alone is insufficient for research peptide specifications. Sequence and bioactivity differ across species despite conserved precursor structure.
| Species | Precursor Protein | Active Fragment | Amino Acid Length | Sequence Homology to Human LL-37 | Primary Antimicrobial Mechanism | Bottom Line |
|—|—|—|—|—|—|
| Human | hCAP-18 | LL-37 | 37 | 100% (reference sequence) | Membrane disruption + FPR2 signaling | The standard for translational research; human-specific receptor interactions |
| Mouse | mCRAMP precursor | CRAMP | 34 | ~60% | Membrane disruption, weaker FPR2 binding | Not a direct functional equivalent; mouse models require validation for human translation |
| Bovine | Bac5/Bac7 precursor | BMAP-27, BMAP-28, BMAP-34 | 27–34 | ~40% | Intracellular RNA/DNA binding | Mechanistically distinct; used in agricultural antimicrobial research, not human immunology |
| Porcine | Protegrin precursor | PR-39, Prophenin | 39–42 | ~35% | Membrane disruption + angiogenesis inhibition | Longer peptide with additional C-terminal residues; different receptor profile |
Cross-species studies attempting to model human LL-37 function using mouse CRAMP encounter two major limitations: sequence divergence and receptor binding differences. Human LL-37 contains the highly conserved FKRIVQRIKDFLR motif responsible for FPR2 binding and chemotactic signaling. Mouse CRAMP has a FKRLKKIGKLKRW sequence in the equivalent region, altering both hydrophobicity and charge distribution. This changes receptor selectivity: CRAMP activates mouse FPR2 ortholog but with 10× lower potency, and it does not activate human FPR2 at physiologically relevant concentrations (<10 µM). Translational conclusions drawn from mouse models require validation with human LL-37 peptide in human cell assays before clinical inference is justified.
The reason cathelicidin same as LL-37 terminology persists in literature is historical. Early papers used 'cathelicidin' generically before species-specific sequences were fully characterized. Modern peptide synthesis standards require exact sequence specification. When ordering research peptides, specifying 'human LL-37' or providing the explicit 37-amino-acid sequence eliminates ambiguity. Real Peptides synthesizes human LL-37 to the published canonical sequence (UniProt ID P49913 residues 134–170), verified by mass spectrometry at every production batch to confirm sequence fidelity and rule out truncation or substitution errors that alter bioactivity.
Key Takeaways
- Cathelicidin same as LL-37 specifically refers to the 37-amino-acid active fragment cleaved from the hCAP-18 precursor protein by proteinase-3 during neutrophil activation.
- The hCAP-18 precursor has no antimicrobial or immunomodulatory activity until cleaved. Only the released LL-37 fragment is bioactive in research applications.
- Human LL-37 shares only ~60% sequence homology with mouse CRAMP, making cross-species functional equivalence assumptions invalid without direct validation.
- Research-grade LL-37 synthesis targets the exact 37-amino-acid post-cleavage sequence starting with leucine-leucine, verified by HPLC and mass spectrometry to ensure >98% purity.
- Ordering 'cathelicidin' without species specification can result in receipt of non-human peptides with different antimicrobial spectrum and receptor binding profiles.
What If: Cathelicidin Same as LL-37 Scenarios
What If I Receive Peptide Labeled 'Cathelicidin' Instead of 'LL-37' — Are They the Same?
Contact your supplier to confirm the exact peptide sequence and species origin. If the supplier documentation lists 'human cathelicidin, active fragment, 37 amino acids,' it is LL-37. If documentation does not specify 'active fragment' or lists molecular weight as 18 kDa, you may have received the inactive hCAP-18 precursor, which will not produce antimicrobial or immunomodulatory effects in standard assays. Request a certificate of analysis showing mass spectrometry confirmation of the 37-amino-acid sequence and N-terminal leucine-leucine residues. This is the definitive verification that cathelicidin same as LL-37 applies to your order.
What If My Research Protocol Cites 'Cathelicidin' but Doesn't Specify LL-37 — Which Should I Use?
Use human LL-37 unless the protocol explicitly requires the hCAP-18 precursor or a non-human ortholog like mouse CRAMP. The vast majority of published cathelicidin research used the active LL-37 fragment because the precursor has negligible bioactivity in vitro. If replicating a published study, check the methods section for peptide supplier and catalog number. If the original study used a 4–5 kDa peptide, it was LL-37; if 18 kDa, it was hCAP-18. When in doubt, LL-37 is the correct choice for antimicrobial assays, immune cell migration studies, and receptor binding experiments.
What If I Need Cathelicidin for Mouse Model Studies — Is Human LL-37 Appropriate?
No. Mouse models should use mouse CRAMP peptide, not human LL-37, unless the research question specifically examines human peptide pharmacokinetics in a murine system. Mouse and human cathelicidins have different receptor binding profiles, tissue distribution, and proteolytic stability. Human LL-37 injected into mice will produce some antimicrobial effects via direct membrane disruption, but immunomodulatory signaling through FPR2 and EGFR will not replicate human responses because murine receptor orthologs have lower binding affinity for the human peptide sequence. If your experimental goal is to model human LL-37 immune function, use human cell assays or humanized mouse models. Wild-type mouse studies require mouse CRAMP for physiological relevance.
What If the Peptide Purity Is Listed as 95% Instead of 98% — Does That Affect Cathelicidin Same as LL-37 Equivalence?
Yes. Purity directly affects reproducibility and dose-response accuracy in immune signaling studies. A 95% pure LL-37 preparation contains up to 5% truncated peptides, deletion sequences, or synthesis byproducts that may have different antimicrobial potency or receptor binding affinity. For antimicrobial killing assays where high micromolar doses are used, 95% purity may be acceptable. For receptor signaling studies at nanomolar concentrations (FPR2 calcium flux assays, chemotaxis), impurities at 5% can introduce confounding ligands that skew dose-response curves. Research-grade LL-37 should meet ≥98% purity by HPLC for publication-quality data. This is the standard Real Peptides guarantees, with every batch tested for sequence fidelity and deletion variant contamination before release.
The Clinical Truth About Cathelicidin Same as LL-37
Here's the honest answer: cathelicidin same as LL-37 only when the context is the bioactive fragment used in research, and even then, the terminology is imprecise. The human cathelicidin precursor hCAP-18 and the cleaved LL-37 peptide are biochemically distinct molecules with entirely different activity profiles. One is an inactive storage protein, the other is a multifunctional immune effector. Researchers who treat the terms as interchangeable risk experimental design errors, particularly when replicating protocols that fail to specify which form was used or when sourcing peptides from suppliers that do not document cleavage status.
The larger issue is cross-species translation. The cathelicidin family name implies functional conservation across mammals, but sequence divergence of 40–60% between species means antimicrobial potency, receptor selectivity, and immune signaling pathways differ substantially. Mouse CRAMP is not a surrogate for human LL-37 in mechanistic studies. It is a related peptide with overlapping but non-identical functions. Translational research that draws human clinical conclusions from mouse cathelicidin data without validating findings in human LL-37 systems overstates the evidence. If your endpoint is human immune function, wound healing, or antimicrobial therapy, the experimental peptide must be human LL-37, synthesized to the exact 37-amino-acid post-cleavage sequence.
The quality of research outcomes depends on peptide specification accuracy and synthesis purity. Cathelicidin ordered generically from suppliers without sequence verification documentation introduces a variable that cannot be controlled post-experiment. You may receive hCAP-18, you may receive a non-human ortholog, or you may receive LL-37 with unknown truncation or substitution errors. Real Peptides eliminates this variable by synthesizing human LL-37 exclusively to the published canonical sequence, with mass spectrometry and HPLC verification at every batch to confirm the leucine-leucine N-terminus, 37-amino-acid length, and >98% purity standard that peer-reviewed journals expect in methods sections. If your research depends on reproducible immune signaling or antimicrobial activity data, peptide sourcing is not a detail to overlook.
The bottom line: cathelicidin same as LL-37 is true only for the cleaved, bioactive, 37-amino-acid human peptide fragment. And specifying that explicitly in your procurement process is the only way to ensure experimental reproducibility. Ambiguity in peptide nomenclature is a preventable source of experimental failure, and the fix is straightforward: order by exact sequence, verify by mass spectrometry, and document the specification in your methods section so other researchers can replicate your work without guessing which peptide you actually used.
Peptide research demands precision at every stage. From sequence specification to reconstitution protocols. When sourcing antimicrobial peptides like LL-37 for immune function studies, the difference between inactive precursor and bioactive fragment determines whether your assay produces meaningful data or wasted time. The research-grade peptides available at Real Peptides are synthesized with exact amino-acid sequencing and verified purity standards, ensuring that cathelicidin same as LL-37 means exactly what your protocol requires: the human, cleaved, bioactive fragment ready for immediate experimental use.
Frequently Asked Questions
Is cathelicidin the same as LL-37 peptide?
▼
Yes, cathelicidin same as LL-37 when referring to the bioactive 37-amino-acid fragment cleaved from the hCAP-18 precursor protein. LL-37 is the active form of human cathelicidin used in laboratory research — the intact hCAP-18 precursor has no antimicrobial activity until proteinase-3 cleavage releases the LL-37 fragment. When ordering peptides for research, specifying ‘LL-37’ ensures you receive the bioactive form rather than the inactive precursor.
How is LL-37 produced from cathelicidin in the body?
▼
Human cathelicidin (hCAP-18) is cleaved by the serine protease proteinase-3 during neutrophil degranulation, releasing the 37-amino-acid LL-37 fragment. The cleavage occurs at a single arginine residue, generating the N-terminus starting with two leucine residues (hence LL-37). This proteolytic processing transforms an inactive storage protein into a functional antimicrobial and immunomodulatory peptide — the cathelin domain of hCAP-18 keeps the peptide inactive until infection or inflammation triggers neutrophil activation.
Can I use mouse cathelicidin instead of human LL-37 in experiments?
▼
No, mouse cathelicidin (CRAMP) is not a functional equivalent of human LL-37 despite belonging to the same precursor family. CRAMP shares only ~60% sequence homology with LL-37 and has 10× lower binding affinity for human FPR2 receptors, resulting in different immunomodulatory signaling. If your research models human immune responses, use human LL-37 peptide — cross-species orthologs produce misleading results in translational studies because receptor selectivity and antimicrobial spectrum differ substantially.
What purity level is required for LL-37 peptide research?
▼
Research-grade LL-37 should be ≥98% pure by HPLC for reproducible immune signaling and antimicrobial assays. Purity below 98% means the preparation contains truncated peptides or synthesis byproducts that can skew dose-response data, particularly in receptor binding studies at nanomolar concentrations. High-purity LL-37 from suppliers like Real Peptides includes sequence verification by mass spectrometry to confirm the exact 37-amino-acid length and leucine-leucine N-terminus required for consistent bioactivity.
Does hCAP-18 precursor have antimicrobial activity before cleavage?
▼
No, intact hCAP-18 has negligible antimicrobial activity until cleaved by proteinase-3 to release LL-37. In vitro killing assays show hCAP-18 exhibits minimal bactericidal effects at concentrations up to 50 µM, whereas LL-37 achieves >90% bacterial killing at 2–5 µM. The cathelin domain in hCAP-18 masks the cationic charge needed for bacterial membrane disruption — only after proteolytic cleavage does the active LL-37 fragment gain antimicrobial function.
Why do some research papers use ‘cathelicidin’ instead of ‘LL-37’?
▼
Early cathelicidin research used the family name generically before species-specific sequences were fully characterized. Many papers cite ‘cathelicidin activity’ when the actual peptide used was human LL-37, creating reproducibility issues for researchers attempting to replicate findings. Modern synthesis standards require exact sequence specification — ‘cathelicidin’ alone could refer to hCAP-18 precursor, LL-37 active fragment, or non-human orthologs like mouse CRAMP, each with different bioactivity profiles.
What receptors does LL-37 bind that the hCAP-18 precursor does not?
▼
LL-37 binds formyl peptide receptor 2 (FPR2), P2X7 purinergic receptors, and epidermal growth factor receptor (EGFR) — none of these interactions occur with uncleaved hCAP-18. The cathelin domain in hCAP-18 sterically blocks the receptor-binding interface present in the LL-37 C-terminal region. These receptor-mediated effects (chemotaxis, wound healing, cytokine modulation) are functional only after proteinase-3 cleavage liberates the LL-37 fragment.
How should LL-37 peptide be stored after reconstitution?
▼
Reconstituted LL-37 peptide should be stored at 2–8°C and used within 28 days to prevent degradation. Lyophilised LL-37 powder must be stored at −20°C before reconstitution. Repeated freeze-thaw cycles degrade peptide structure — aliquot reconstituted LL-37 into single-use volumes to avoid multiple temperature excursions. Bacteriostatic water is the standard reconstitution solvent for peptides intended for in vitro assays, providing antimicrobial preservation during refrigerated storage.
What is the amino acid sequence of human LL-37?
▼
Human LL-37 has the 37-amino-acid sequence: [LL-37, 37 aa] The N-terminus starts with two leucine residues (LL), and the sequence corresponds to residues 134–170 of the hCAP-18 precursor protein (UniProt ID P49913). Any truncation or amino acid substitution in this sequence alters antimicrobial potency and receptor binding affinity — research-grade synthesis must replicate this exact sequence to ensure functional equivalence to endogenously cleaved LL-37.
Can cathelicidin same as LL-37 be used in wound healing research?
▼
Yes, LL-37 accelerates wound closure in keratinocyte scratch assays via EGFR transactivation and promotes angiogenesis. However, the hCAP-18 precursor will not produce these effects unless the experimental system includes proteinase-3 to cleave it in situ. Wound healing studies require the bioactive LL-37 fragment, not the precursor — the peptide must be post-cleavage to interact with EGFR and stimulate keratinocyte migration.
What documentation should accompany research-grade LL-37?
▼
Research-grade LL-37 should include a certificate of analysis showing HPLC purity ≥98%, mass spectrometry confirmation of the 37-amino-acid sequence, and verification of the N-terminal leucine-leucine residues. This documentation confirms the peptide is the bioactive fragment, not the hCAP-18 precursor or a truncated variant. Suppliers like Real Peptides provide sequence verification with every batch to ensure cathelicidin same as LL-37 means the exact post-cleavage peptide your protocol requires.
Why does sequence homology matter when comparing human LL-37 to other species?
▼
Sequence homology determines receptor binding affinity and antimicrobial spectrum — human LL-37 and mouse CRAMP share only ~60% sequence identity, resulting in 10× different FPR2 binding potency. Cross-species functional equivalence cannot be assumed based on precursor family membership alone. Translational research modeling human immune responses requires human LL-37, not mouse or bovine cathelicidin orthologs, because receptor selectivity and signaling pathways diverge substantially with sequence changes.