How to Read Tirzepatide COA — Critical Quality Markers

The contamination rate in unverified peptide batches exceeds 40% according to independent testing conducted at the University of Texas Health Science Center. Yet most researchers can't identify quality failures in a Certificate of Analysis (COA) even when they're holding one. That document is the only real-time quality assurance you have before reconstituting a peptide, and most people read it like a terms-of-service agreement. They scan for a purity percentage, see something above 95%, and assume they're good. They're not.

Our team has evaluated hundreds of COAs across peptide categories. The gap between understanding what the numbers mean and just trusting what the label says comes down to three markers most guides never mention. Endotoxin contamination levels, amino acid sequence confirmation, and batch traceability to a specific synthesis run.

'How do you read tirzepatide COA documents to verify quality before use?'

To read tirzepatide COA, verify the purity percentage (≥98% is research-grade standard), confirm endotoxin levels below 1.0 EU/mg, check amino acid sequence match to published tirzepatide structure, and cross-reference batch number to the vial label. The sterility test result must state 'No growth detected'. Anything vague means contamination risk. These five markers determine whether the peptide is safe for research use.

Most people assume a COA is binary. Either the peptide passed or it didn't. That's not how analytical chemistry works. A COA reports what was measured, not what's acceptable. If endotoxin testing wasn't performed, the document won't say 'failed endotoxin test'. It'll just omit the section entirely, and you won't notice unless you know to look for it. This article covers the five critical markers every COA must contain, what numeric thresholds separate research-grade from contaminated material, and what the absence of specific test results actually means about manufacturing oversight.

Step 1: Verify Purity Percentage and Testing Method Used

The purity percentage is the first number everyone looks at, and it's also the most misunderstood. When a COA states '98.3% purity,' that figure represents the proportion of the peptide that matches the target molecular structure. Confirmed via High-Performance Liquid Chromatography (HPLC). HPLC separates the sample into individual molecular components based on retention time, generating a chromatogram that shows peaks for each compound present. The area under the curve (AUC) for the tirzepatide peak, divided by the total AUC for all peaks, yields the purity percentage.

Research-grade tirzepatide should demonstrate ≥98% purity. Anything between 95–98% is acceptable for non-clinical applications but signals potential synthesis inconsistencies. Below 95%, the peptide contains significant impurities. Truncated sequences, deletion analogs, or oxidation byproducts. That compromise dose accuracy and introduce unknown variables into any experiment. We've reviewed batches from compounding facilities where the listed purity was 97.8% but the chromatogram showed three unidentified peaks accounting for the remaining 2.2%. Those peaks weren't named, quantified, or tested for biological activity.

The COA must specify the HPLC method used. Reverse-phase HPLC is standard for peptide analysis because it separates molecules based on hydrophobicity. If the document states 'purity confirmed by analytical methods' without naming HPLC explicitly, that's deliberate vagueness. A legitimate COA includes the chromatogram itself as an appendix or attachment. Look for baseline separation between peaks. Overlapping peaks mean the method couldn't resolve impurities from the target peptide, making the purity figure unreliable.

Step 2: Confirm Endotoxin Levels Below Regulatory Threshold

Endotoxins are lipopolysaccharides (LPS) shed by gram-negative bacteria during peptide synthesis and purification. They're heat-stable, meaning standard autoclaving doesn't eliminate them, and they trigger inflammatory responses even at sub-microgram concentrations. For injectable peptides, the FDA threshold is <5.0 Endotoxin Units per milligram (EU/mg) for most applications. Research-grade peptides should target <1.0 EU/mg. Stricter than the regulatory minimum because lower endotoxin burden reduces experimental noise in metabolic studies.

The COA must report endotoxin testing using the Limulus Amebocyte Lysate (LAL) assay, which detects LPS via a clotting reaction in horseshoe crab blood cells. If the document omits endotoxin testing entirely, that peptide wasn't manufactured under pharmaceutical-grade conditions. Compounding facilities operating below USP <797> standards frequently skip endotoxin testing to reduce costs. The absence of this data point is more significant than a high reading. It means the manufacturer didn't test, not that the peptide passed.

When endotoxin levels exceed 1.0 EU/mg, the peptide induces systemic inflammation unrelated to the peptide's pharmacological activity. In GLP-1 research, this confounds metabolic measurements. Inflammation itself alters insulin sensitivity, increases cortisol, and shifts energy partitioning. At Real Peptides, every batch undergoes LAL testing before shipment, and results below 0.5 EU/mg are standard across our full peptide collection. If your COA lists endotoxin levels above 1.0 EU/mg, reject the batch.

Step 3: Cross-Reference Amino Acid Sequence to Published Structure

Tirzepatide is a 39-amino-acid peptide with a specific sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-γGlu-2xOEG-γGlu(C20 diacid). That exact sequence must appear in the COA under 'Amino Acid Sequence Analysis' or 'Mass Spectrometry Confirmation.' The document should state either 'Sequence matches theoretical structure' or provide the full amino acid breakdown. If the COA lists only molecular weight without sequence verification, the manufacturer confirmed the peptide weighs the right amount but didn't verify what molecules comprise that weight.

Mass spectrometry (MS) is the gold standard for sequence confirmation. The COA should report observed molecular weight within ±0.5 Daltons of the theoretical value (4,813.5 Da for tirzepatide). Larger deviations indicate synthesis errors. Missed couplings, incomplete deprotection, or sequence scrambling during solid-phase peptide synthesis (SPPS). A peptide with 98% purity but incorrect sequence is worse than a lower-purity peptide with correct structure, because you're dosing the wrong compound entirely.

Our experience working with research institutions has shown that sequence mismatches most commonly occur at lipidation sites. The C20 diacid chain attached to tirzepatide's glutamate residues. If that lipid chain is absent or incorrectly attached, the peptide loses its prolonged half-life (the lipid chain binds to albumin, extending circulation time from hours to days). The COA must explicitly confirm lipidation. Not just sequence. Look for 'lipidation confirmed by LC-MS' or equivalent language. Generic statements like 'structure verified' don't distinguish between deacylated and properly lipidated peptide.

How to Read Tirzepatide COA: Quality Standards Comparison

What If: Tirzepatide COA Scenarios

What If the COA Shows 96% Purity — Is That Acceptable?

Use it only for preliminary experiments where dose precision isn't critical. The 4% impurity fraction may contain deletion sequences (missing amino acids), oxidized methionine residues, or synthesis byproducts that don't activate GLP-1 or GIP receptors. In dose-response studies, that 4% introduces noise. You're not dosing 5mg of active tirzepatide, you're dosing 4.8mg active plus 0.2mg of unknown analogs. For any study intended for publication, reject batches below 98% purity.

What If Endotoxin Testing Is Listed as 'Pending' or 'Not Available'?

Don't use the peptide until results are provided. 'Pending' usually means the manufacturer sent the peptide before completing QC testing. A practice that violates Good Manufacturing Practice (GMP) protocols. Contact the supplier and request the final LAL assay result before reconstitution. If they can't provide it within 48 hours, the test was never performed. At Real Peptides, LAL testing is completed before any peptide ships. No exceptions.

What If the Amino Acid Sequence Section Is Missing Entirely?

Request mass spectrometry data directly from the manufacturer. If they can't provide it, assume the peptide is either a generic GLP-1 analog sold as tirzepatide or a batch that failed sequence verification. We've encountered suppliers who label any dual-agonist peptide as 'tirzepatide' without confirming the exact structure. Without sequence data, you have no proof the peptide matches published tirzepatide structure, making any experimental results unpublishable.

What If the COA Batch Number Doesn't Match the Vial Label?

Do not use the peptide. This represents a catastrophic traceability failure. Either the COA was issued for a different batch, the vial was mislabeled during packaging, or the manufacturer reused COAs across multiple batches to reduce testing costs. Contact the supplier immediately and request a corrected COA matching the vial's lot number. If they can't provide one, the peptide's quality status is unknown. Mislabeling errors like this are how contaminated batches enter research labs.

The Uncomfortable Truth About Reading Tirzepatide COA Documents

Here's the blunt answer: most COAs from non-pharmaceutical suppliers are formatted to look comprehensive while omitting the tests that would reveal quality failures. The document lists purity, molecular weight, and maybe sterility. But skips endotoxin testing, sequence verification, and chromatogram data. That's not an oversight. It's a cost reduction strategy. Running a full LAL assay adds $150–$250 per batch. Mass spectrometry for sequence confirmation costs $300–$500. Facilities cutting corners skip those tests and hope you won't notice their absence.

The question isn't whether the peptide passed QC. It's whether QC was performed at all. A 'Certificate of Analysis' with three data points isn't an analysis. It's a spec sheet. If the COA doesn't include a chromatogram, endotoxin data, sequence confirmation, and batch-specific sterility results, you're trusting marketing claims instead of analytical chemistry. We mean this sincerely: the peptide industry operates with minimal regulatory oversight outside FDA-approved drugs. The COA is your only verification. If it's incomplete, the peptide is unverified.

Most researchers don't reject peptides over incomplete COAs because they assume 'everyone else is using this supplier, so it must be fine.' That's not risk assessment. That's herd mentality. One contaminated batch doesn't just invalidate your current experiment. It calls into question every prior result from that supplier's peptides. Our team has reviewed facilities where 'research-grade' peptides were synthesized in shared equipment with veterinary compounds, never subjected to endotoxin testing, and released with COAs listing 'purity >95%' as the only quality metric. Those peptides ship to universities, private labs, and compounding pharmacies every week.

The standard needs to be higher. If you can't verify purity via chromatogram, confirm sequence via mass spec, and document endotoxin levels below 1.0 EU/mg, you shouldn't use the peptide. Full stop. Not 'use it cautiously.' Not 'probably fine for preliminary work.' Reject it.

Understanding how to read tirzepatide COA documents isn't optional expertise for researchers working with GLP-1 or GIP agonists. It's the baseline standard for reproducible science. If your current supplier can't provide complete analytical data for every batch, find one who can. The integrity of your work depends on it. And so does the credibility of peptide research as a field.

References

Peer-reviewed sources on Tirzepatide indexed in PubMed, listed for research context. Real Peptides supplies Tirzepatide for laboratory research use only.

1. Anti-inflammatory effects of tirzepatide: a systematic review and meta-analysis. Reviews in endocrine & metabolic disorders, 2026. PMID 41032183. doi:10.1007/s11154-025-09991-4
2. The promise of tirzepatide: A narrative review of metabolic benefits. Primary care diabetes, 2025. PMID 40221292. doi:10.1016/j.pcd.2025.03.008
3. Subcutaneously administered tirzepatide vs semaglutide for adults with type 2 diabetes: a systematic review and network meta-analysis of randomised controlled trials. Diabetologia, 2024. PMID 38613667. doi:10.1007/s00125-024-06144-1
4. Tirzepatide: A Review in Type 2 Diabetes. Drugs, 2024. PMID 38388874. doi:10.1007/s40265-023-01992-4
5. Tirzepatide, the Newest Medication for Type 2 Diabetes: A Review of the Literature and Implications for Clinical Practice. The Annals of pharmacotherapy, 2023. PMID 36367094. doi:10.1177/10600280221134127
6. Efficacy and safety of tirzepatide for treatment of overweight or obesity. A systematic review and meta-analysis. International journal of obesity (2005), 2023. PMID 37253796. doi:10.1038/s41366-023-01321-5
7. Tirzepatide cardiovascular event risk assessment: a pre-specified meta-analysis. Nature medicine, 2022. PMID 35210595. doi:10.1038/s41591-022-01707-4
8. Tirzepatide: A Systematic Update. International journal of molecular sciences, 2022. PMID 36498958. doi:10.3390/ijms232314631