LL-37 · Research brief

LL-37 Lab Tested: What Purity Data Should Show

Real Peptides Research TeamEditorial

Updated September 22, 202610 min read

60 WORDS

Short answer

Most people buying research peptides check one number on the certificate of analysis: the purity percentage. That's the least informative figure on the page. A vial can read 98% pure by HPLC and still contain substantially less peptide by mass than the label states, because purity and peptide content measure two completely different things — and only one of them…

Key takeaways

LL-37 lab tested means third-party HPLC purity analysis plus mass spectrometry identity confirmation on a batch-matched certificate — not an unsupported label claim.
HPLC purity is a relative measure of peptide composition; net peptide content is the absolute measure of how much peptide is in the vial, and the two figures are routinely different.
LL-37's strongly cationic 37-residue structure binds counter-ions such as trifluoroacetate tightly, which is why salt and residual water can account for a meaningful fraction of total vial mass.
A batch-specific certificate carries a unique lot number, separate synthesis and test dates, the analysing laboratory's name, and raw chromatogram output with visible baseline noise.
Verify the CAS number and published amino acid sequence independently before purchase — a listing that states neither gives you nothing to check the COA against.
LL-37 is supplied by Real Peptides strictly as a research-use-only compound and is not an FDA-approved drug for human or veterinary use.

Our team has reviewed hundreds of certificates across the research peptide supply chain. The pattern is consistent: the suppliers who make their documentation hardest to find are the ones whose documentation is worth reading most carefully. When a listing says LL-37 lab tested but no COA is linked, that phrase is marketing copy, not analytical data.

What does LL-37 lab tested actually mean?

LL-37 lab tested means the specific synthesis batch has been analysed by an independent laboratory using reversed-phase HPLC for purity and mass spectrometry for molecular identity, with results published on a batch-matched certificate of analysis. A genuine LL-37 lab tested claim names the testing lab, the batch number, and the analytical methods used.

Here's where most buyers go wrong: they treat LL-37 lab tested as a binary state rather than a document with readable content. A COA that reports purity but omits peptide content, water content, or counter-ion data leaves out the variables that determine how much active compound is in the vial. This piece covers how HPLC and mass spectrometry results should be read, why net peptide content diverges from purity, and what separates a batch-specific COA from a template.

What the analytical methods actually measure

Two tests carry the weight of any LL-37 lab tested claim, and they answer different questions. Reversed-phase high-performance liquid chromatography (RP-HPLC) separates the contents of the vial by hydrophobicity and reports what fraction of the UV-absorbing material is the target peptide. Mass spectrometry — usually electrospray ionisation, ESI-MS — measures molecular weight to confirm the material actually is LL-37 and not a truncated or deletion sequence.

Purity without identity is meaningless. A batch can be 99% one compound and that compound can be the wrong peptide. LL-37 is a 37-amino-acid cathelicidin-derived fragment with a theoretical monoisotopic mass in the region of 4.49 kDa; the mass spec trace on a legitimate COA should show an observed mass that matches the calculated mass within the instrument's stated tolerance.

What the HPLC trace shows matters as much as the number printed beneath it. A clean chromatogram has one dominant peak with a sharp, symmetrical shape. Shoulders on the main peak usually indicate deletion sequences — chains missing a single amino acid — which are the most common synthesis byproduct in long peptides like LL-37 and the hardest to separate out. At 37 residues, LL-37 sits in the length range where solid-phase peptide synthesis yields drop and deletion products accumulate.

We've seen certificates where the reported purity is 98% but the attached chromatogram image is illegible, cropped, or from a different batch entirely. Look at the image. If the batch number on the chromatogram doesn't match the batch number on the vial, the LL-37 lab tested claim is decorative.

Why net peptide content is the number nobody reads

Here's the mechanism most sourcing guides skip entirely. HPLC purity is a relative measure — it tells you what percentage of the peptide material is your target sequence. Net peptide content is an absolute measure: what percentage of the total powder mass in the vial is actually peptide.

The gap between them is real and it's often large. Lyophilised synthetic peptides carry residual water, and they carry counter-ions left over from purification. LL-37 is a strongly cationic peptide — it carries a high net positive charge, which is central to how it interacts with anionic bacterial membranes in the published literature. That cationic character means it binds counter-ions tightly, most commonly trifluoroacetate (TFA) from the purification step or acetate if the batch has undergone salt exchange. Those salts have mass. So does bound water.

The practical consequence: a vial labelled 5mg of a 98% pure cationic peptide may contain meaningfully less than 5mg of actual peptide once salt and water are subtracted. For a compound as charged as LL-37, this is not a rounding error. Any researcher calculating concentration in mg per mL from label weight alone, without checking net peptide content on the certificate, is working from a number that may be off.

This is the single most useful thing a COA can tell you and the field where template certificates most often go blank. Amino acid analysis or nitrogen determination is what generates that figure, and it costs money to run — which is precisely why budget suppliers omit it.

Batch-specific COAs versus template documents

A legitimate LL-37 lab tested certificate is generated for one synthesis batch and cannot be reused. A template COA is a design file with the numbers typed in. Distinguishing them takes about ninety seconds.

Check whether the certificate carries a unique batch or lot number that matches the vial label, a synthesis date and a test date that are different from each other, the name of the analysing laboratory, and raw instrument output rather than a summary table. Real chromatograms have baseline noise, retention times to two decimal places, and integration marks. Marketing graphics don't.

A certificate that reports identical purity figures across every batch of every compound in a catalog is not reporting measurements. Analytical results vary batch to batch because synthesis varies batch to batch.

Third-party testing means the lab running the analysis has no financial stake in the result. In-house QC is genuinely useful and most reputable manufacturers run it, but it isn't independent. Where our team sees the clearest separation in the market is between suppliers who publish COAs openly and those who send one only after purchase — Real Peptides maintains publicly accessible certificates of analysis for catalog batches, which is the standard any researcher should expect before procurement rather than after.

The other pre-purchase check: verify molecular identity independently. LL-37 has a documented CAS registry number and a published sequence ([LL-37, 37 aa]). If a listing for ll37 peptide for sale doesn't state the sequence or the CAS number, there is nothing to verify the certificate against.

LL-37 Lab Tested: Documentation Quality Comparison

Not all testing documentation carries the same evidentiary weight. This table breaks down what each documentation tier actually proves and where it falls short.

Documentation Tier	What It Proves	What It Omits	Bottom Line
No COA, 'lab tested' claim only	Nothing verifiable	Purity, identity, batch traceability, peptide content	Treat the phrase as marketing copy; there is no data to evaluate
In-house COA, purity only	Manufacturer's own HPLC purity figure for a stated batch	Independent verification, mass spec identity, net peptide content	Useful as a starting point but unverified by any outside party
Third-party HPLC + MS, batch-matched	Independent purity figure and confirmed molecular identity for that specific lot	Net peptide content, residual solvent and water data	The working minimum for research procurement in 2026
Third-party HPLC + MS + peptide content	Purity, identity, and the absolute mass of peptide in the vial	Sterility and endotoxin data, which require separate assays	The most complete documentation standard commonly available for research-use peptides

What If: LL-37 Sourcing Scenarios

What if the supplier only sends the COA after I place the order?

Treat post-purchase COA delivery as a documentation red flag and request the batch certificate before paying. Suppliers who publish certificates openly have nothing to hide in the chromatogram; suppliers who gate them control which document you see and when. Our team's view is that pre-purchase COA access is the baseline expectation for anyone looking to buy LL-37 peptide for laboratory work, not a premium feature.

What if the purity is 99% but there's no net peptide content listed?

Assume you don't know the actual peptide mass in the vial and ask the supplier for amino acid analysis data. A 99% HPLC figure confirms the peptide material is overwhelmingly the target sequence; it says nothing about how much of the lyophilised powder is peptide versus TFA salt and bound water. For concentration calculations in mg per mL, the peptide content figure is the one that matters.

What if the mass spec result is slightly off from the theoretical mass?

Small deviations within the instrument's stated tolerance are normal; large deviations indicate a sequence problem. Observed mass that differs from calculated mass by roughly the weight of a single amino acid residue points to a deletion sequence contaminating the batch. A COA reporting a mass mismatch without explanation should prompt a direct question to the supplier before the material enters any experiment.

What if I need dosing or reconstitution guidance for LL-37?

Real Peptides does not provide dosing, preparation, or administration guidance, because LL-37 is a research-use-only compound and not an approved therapeutic. What a certificate does support is concentration framework work: the labelled vial mass and the net peptide content figure are the two inputs for any mg-per-mL calculation a laboratory performs under its own protocols.

The Uncomfortable Truth About LL-37 Purity Claims

Let's be direct about this: the phrase LL-37 lab tested carries no regulatory definition and no enforcement behind it. Any seller can print it. Nothing stops a listing from claiming LL-37 lab tested while the underlying material has never been analysed by an independent laboratory at all.

The only thing that makes the claim meaningful is a document you can read, matched to a batch number you can verify on the vial in front of you. Research on LL-37's antimicrobial and immunomodulatory activity is genuinely substantial — the cathelicidin literature is deep and ongoing. But that literature was generated using characterised material of known purity and known peptide content. Experiments run on uncharacterised peptide produce uninterpretable results, no matter how good the hypothesis was.

What genuine supply-side quality control looks like

Small-batch synthesis exists for a reason that has nothing to do with marketing. Peptide synthesis is a stepwise chemical process where coupling efficiency compounds across every residue — at 37 amino acids, even a high per-step efficiency produces a measurable population of truncated chains by the final coupling. Smaller batches allow tighter control over reaction conditions and make purification more effective, which is why batch size and achievable purity are linked for longer sequences like LL-37.

The information in this article is educational and describes laboratory sourcing practice; all compounds discussed are for research use only and are not intended for human or veterinary consumption. Real Peptides supplies LL-37 and its wider catalog under exactly that framing, with exact amino-acid sequencing verified per batch and certificates published for review. Researchers evaluating ll37 peptide options alongside other compounds can review the full research catalog or check supply details on the company information page, where the same documentation standard applies to every compound listed rather than to a single flagship product.

That consistency is the real test. A supplier who publishes rigorous data for one popular compound and nothing for the rest of the catalog isn't running a quality system — they're running a marketing campaign on one SKU.

The next time you see a listing advertising LL-37 lab tested, open the certificate before you open your wallet. Scroll past the purity headline, find the batch number, check it against the vial, and look for the peptide content figure. Ninety seconds of reading tells you more about what you're buying than any amount of product-page copy. The suppliers worth using are the ones who made that ninety seconds easy for you — and the gap between those suppliers and the rest of the market is entirely visible in a document they either published or didn't.

References

Peer-reviewed sources on LL-37 indexed in PubMed, listed for research context. Real Peptides supplies LL-37 for laboratory research use only.

Cathelicidin LL-37-ApoB-100 interaction promotes LDL clearance and attenuates cholesterol accumulation in the liver. Science China. Life sciences, 2026. PMID 40971038. doi:10.1007/s11427-025-3006-2
Cancer cell migration under control of human cathelicidin LL-37. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 2026. PMID 41916132. doi:10.1016/j.biopha.2026.119241
Cathelicidin LL-37-Induced Transcriptome of Human Keratinocyte Identifies Chemokine CXCL10 Link to T-Cell-Mediated Rosacea Pathogenesis through Jak1/STAT1 Pathway. The Journal of investigative dermatology, 2026. PMID 40835085. doi:10.1016/j.jid.2025.08.003
Antimicrobial peptide LL-37 increases rhinovirus-induced interferon β expression in human airway epithelial cells through a Ca(2+)-dependent mechanism. Biochemistry and biophysics reports, 2025. PMID 40612001. doi:10.1016/j.bbrep.2025.102105
Study of cathelicidin (LL-37) immunoexpression in the skin of vitiligo patients. Archives of dermatological research, 2025. PMID 39873762. doi:10.1007/s00403-025-03801-2
Human cathelicidin LL-37 rapidly disrupted colonic epithelial integrity. Biochimica et biophysica acta. Biomembranes, 2025. PMID 39837472. doi:10.1016/j.bbamem.2025.184410
LL-37 as a biomarker for therapeutic response to scaling and root planing. Journal of Indian Society of Periodontology, 2025. PMID 41438788. doi:10.4103/jisp.jisp_405_24
Vitamin D triggers hCAP18/LL-37 production: Implications for LL-37-induced human osteoblast cytotoxicity. Biochemical and biophysical research communications, 2024. PMID 38642493. doi:10.1016/j.bbrc.2024.149962

Questions

LL-37 lab tested means a specific synthesis batch has been analysed by an independent laboratory, typically using reversed-phase HPLC to determine purity and mass spectrometry to confirm molecular identity. The claim is only meaningful when it comes with a batch-matched certificate of analysis that names the testing laboratory and the analytical methods used. Without an accessible COA carrying a lot number that matches the vial, the phrase is marketing language rather than analytical data.

Start with the batch or lot number and confirm it matches the vial label exactly. Then check three things: the HPLC purity percentage and its accompanying chromatogram, the mass spectrometry result against LL-37's theoretical molecular weight of roughly 4.49 kDa, and the net peptide content figure. A genuine certificate shows raw instrument output with visible baseline noise and retention times, not a clean summary graphic.

HPLC purity is relative — it reports what percentage of the peptide material in the vial is the target sequence. Net peptide content is absolute — it reports what percentage of the total powder mass is actually peptide, after subtracting counter-ions and residual water. Because LL-37 is strongly cationic and binds trifluoroacetate or acetate salts tightly, the two figures can differ substantially, which matters for any mg-per-mL concentration calculation.

No. LL-37 supplied by research peptide vendors including Real Peptides is designated research use only and is not an FDA-approved drug for human or veterinary consumption. It is sold to researchers and laboratories for in vitro and laboratory investigation under the purchasing institution's own protocols. Any listing marketing LL-37 for human use is operating outside the regulatory framework that governs research-use-only compounds.

LL-37 is 37 amino acids long, and solid-phase peptide synthesis builds chains one residue at a time with coupling efficiency that compounds across every step. Longer sequences accumulate more deletion products — chains missing a single amino acid — which are chemically very similar to the target and therefore difficult to separate during purification. This is why deletion sequences show up as shoulders on the main HPLC peak and why chromatogram shape is worth examining, not just the purity number.

Pricing varies widely by supplier, vial size, and batch, but independently tested material consistently costs more than untested material because third-party HPLC, mass spectrometry, and amino acid analysis each carry real laboratory fees. The cost difference reflects analysis that has actually been performed. Suppliers advertising research peptides at prices well below the market norm are usually absorbing that gap by skipping the analytical work rather than by operating more efficiently.

In-house quality control is genuinely useful and most reputable manufacturers run it, but it is not independent — the party reporting the result is the party selling the product. Third-party analysis means the testing laboratory has no financial stake in the outcome. The strongest documentation combines both: manufacturer QC during production plus independent verification of the final batch, with both sets of results traceable to the same lot number.

Stop and contact the supplier before using the material in any experiment. A mismatched batch number means the certificate describes a different production lot, so none of its purity, identity, or peptide content data applies to the vial you received. This is one of the most common documentation failures in the research peptide market and it renders the LL-37 lab tested claim unverifiable for that specific unit.

Lyophilised LL-37 follows the same general handling principles as other synthetic peptides: it is supplied as a dry powder and stability depends on temperature control and protection from moisture, with cold storage standard for long-term holding. Because LL-37 is highly cationic, it is also prone to adsorbing to glass and certain plastic surfaces in solution, which laboratories account for in their own handling protocols. Specific storage conditions for a given batch should be taken from the supplier's product documentation.

LL-37 has a published 37-residue amino acid sequence and a registered CAS number, both of which appear in public chemical and peptide databases. Cross-checking the sequence and CAS number on a product listing against those public records takes a few minutes and confirms the supplier is describing the correct compound. If a listing for LL-37 states neither the sequence nor the CAS number, there is no reference point against which to validate the certificate of analysis.

Net peptide content is the most commonly omitted field, because it requires amino acid analysis or nitrogen determination and adds real cost to the testing panel. Residual solvent data and water content are frequently absent as well. Sterility and endotoxin figures require separate assays entirely and are rarely included on standard research-use certificates, so their absence is normal rather than a red flag — the absence of peptide content is the more meaningful gap.

RESEARCH USE ONLY · NOT EVALUATED BY THE FDA