New Launch Site Discount — 40% off sitewide · +10% with Bank Pay · New customers stack 40% off

LL-37

From $80.00

Shop

LL-37 · Research brief

LL-37 Real vs Fake: How to Tell — Verification Guide

58 WORDS

Short answer

Fewer than 30% of peptide researchers verify their compounds beyond reading the label. And that's the gap where contaminated batches, underdosed vials, and outright fakes slip through. A 2024 analysis published in Analytical Chemistry found that 18% of commercially available antimicrobial peptides tested below stated purity, with some samples containing less than 60% of the claimed active compound.

Key takeaways

  • Authentic LL-37 peptides are verified through third-party COAs showing HPLC purity ≥98%, mass spectrometry confirmation of 4493.3 Da molecular weight, and endotoxin testing <0.1 EU/mg.
  • Real LL-37 dissolves completely in sterile water within 90 seconds, forming a clear solution with pH 6.5–7.5. Cloudiness or precipitate indicates contamination or fake product.
  • Counterfeit LL-37 frequently lacks independent lab verification, shows off-target molecular weight in mass spectrometry, or fails standard antimicrobial bioassays against E. coli and S. aureus .
  • Research-grade LL-37 maintains antimicrobial activity at concentrations as low as 2–10 μg/mL. Activity only at 100× expected concentration or complete absence of effect indicates degraded or fake peptide.
  • Functional testing in cell culture (neutrophil chemotaxis, cytokine release assays) provides verification when authentic LL-37 produces dose-dependent responses matching published data.
  • Suppliers providing full batch traceability, third-party analytical testing, and sterile packaging under inert gas are the only reliable sources for research-grade LL-37.

Fewer than 30% of peptide researchers verify their compounds beyond reading the label. And that's the gap where contaminated batches, underdosed vials, and outright fakes slip through. A 2024 analysis published in Analytical Chemistry found that 18% of commercially available antimicrobial peptides tested below stated purity, with some samples containing less than 60% of the claimed active compound. LL-37 (cathelicidin antimicrobial peptide) is particularly vulnerable because its high price point and complex synthesis create financial incentive for shortcuts.

We've guided research teams through this exact verification process across hundreds of peptide orders. The gap between authentic LL-37 and counterfeit product comes down to three checkpoints most purchasing protocols ignore entirely.

How do you tell if LL-37 peptide is real or fake?

Authentic LL-37 peptides are verified through third-party Certificates of Analysis (COA) showing HPLC purity ≥98%, mass spectrometry confirmation of the 37-amino-acid sequence (4493.3 Da molecular weight), and sterility testing via LAL endotoxin assay. Counterfeit LL-37 typically lacks independent lab verification, shows inconsistent reconstitution behavior, or contains contamination visible under 280nm UV spectroscopy. Real Peptides produces every batch with exact amino-acid sequencing and provides full COA documentation with every order.

Yes, verifying LL-37 authenticity protects research validity. But the mechanism isn't what most assume. Counterfeit peptides don't just underperform; they introduce variables (bacterial endotoxins, incorrect analogs, degraded fragments) that corrupt datasets entirely. This guide covers the three verification checkpoints that matter, the specific tests that differentiate real from fake, and what preparation mistakes researchers make that waste authentic compounds.

The Three Verification Checkpoints That Separate Real LL-37 From Counterfeits

Authentic LL-37 (human cathelicidin antimicrobial peptide) consists of exactly 37 amino acids in a precise sequence: [LL-37, 37 aa] Any deviation. A single substituted residue, truncated chain, or incorrect folding. Produces a molecule that is not LL-37. Verification starts with documentation, not the vial.

The first checkpoint is third-party analytical testing. Real suppliers provide Certificates of Analysis from independent labs showing HPLC (high-performance liquid chromatography) purity. The standard for research-grade LL-37 is ≥98% purity. Anything below 95% introduces enough contaminants to skew antimicrobial assays or immune response studies. Mass spectrometry confirms molecular weight (4493.3 Da for LL-37). A reading outside ±2 Da indicates incorrect synthesis or degradation. Fake peptides either lack COAs entirely or present in-house testing that can't be verified.

The second checkpoint is packaging and labeling accuracy. Authentic LL-37 arrives as lyophilized (freeze-dried) white powder in sterile vials sealed under inert gas to prevent oxidation. The label must state exact mass (typically 1mg, 2mg, or 5mg), storage conditions (−20°C before reconstitution), and batch number traceable to manufacturing records. Counterfeit batches often show vague labeling ('LL-37 Peptide, High Purity'), no batch traceability, or inconsistent vial sealing. Our team has reviewed orders where fake suppliers shipped powder in non-sterile containers or listed concentrations without corresponding mass data.

The third checkpoint is reconstitution behavior. Real LL-37 dissolves completely in sterile water or PBS within 60–90 seconds of gentle mixing, producing a clear to slightly opalescent solution. Cloudiness, precipitate, or incomplete dissolution indicates contamination or degraded product. Fake LL-37 frequently contains filler excipients (mannitol, glycine) that alter solubility or leave visible residue. Testing pH post-reconstitution provides another signal. LL-37 in neutral buffer should read pH 6.5–7.5; acidic or alkaline readings suggest incorrect formulation.

Laboratory Testing Protocols to Confirm LL-37 Authenticity

No visual inspection replaces analytical verification. Even experienced researchers cannot distinguish real from fake LL-37 by appearance alone. The definitive tests require lab equipment.

HPLC with UV detection at 214nm or 220nm separates peptide components by retention time. Authentic LL-37 produces a single sharp peak at a characteristic retention time (typically 18–22 minutes depending on column and gradient). Multiple peaks, broad peaks, or retention times inconsistent with reference standards indicate impurity or incorrect peptide. HPLC purity is calculated as area-under-curve for the main peak divided by total integrated area. ≥98% is the research standard. Suppliers should provide HPLC chromatograms with every batch; absence of this data is an immediate red flag.

Mass spectrometry (MS) confirms molecular identity. Electrospray ionization (ESI) or MALDI-TOF mass spec measures exact molecular weight. LL-37's theoretical mass is 4493.3 Da. Authentic samples read within ±2 Da. Deviations outside this range mean the peptide is not LL-37. MS also detects truncated sequences (lower molecular weight) or dimerization (double the expected mass). Our experience shows that counterfeit peptides marketed as LL-37 frequently return MS readings 50–200 Da off target, corresponding to missing or substituted amino acids.

Endotoxin testing via LAL (Limulus Amebocyte Lysate) assay measures bacterial contamination. LL-37 is an antimicrobial peptide used in immune studies. Endotoxin contamination >1 EU/mg corrupts results by triggering inflammatory responses independent of the peptide's activity. Research-grade LL-37 must test <0.1 EU/mg. Fake batches often skip sterility steps during synthesis, resulting in endotoxin levels 10–100× higher than acceptable. This contamination is invisible but renders the product unusable for cell culture or in vivo work.

What Real LL-37 Should Look Like and How It Should Perform

Authentic LL-37 arrives as a white to off-white lyophilized powder with a cotton-like or crystalline texture. The vial should be under vacuum or inert gas (nitrogen or argon). A hissing sound when first opened indicates proper sealing. Discoloration (yellow, brown) or clumping before reconstitution suggests oxidation or moisture exposure during storage.

After reconstitution with sterile water or PBS, LL-37 should form a clear solution within 90 seconds of gentle swirling. Concentration typically ranges from 0.5mg/mL to 2mg/mL for stock solutions. The reconstituted peptide remains stable at 2–8°C for 7–10 days or −20°C for up to six months without significant degradation. Authentic LL-37 maintains antimicrobial activity against E. coli, S. aureus, and Pseudomonas aeruginosa at concentrations as low as 2–10 μg/mL in standard MIC (minimum inhibitory concentration) assays. Activity below this range or complete absence of antimicrobial effect indicates fake or degraded product.

Functional testing in cell culture provides another verification layer. LL-37 modulates immune cell activity by binding to formyl peptide receptor-like 1 (FPRL1) and P2X7 receptors, inducing chemotaxis in neutrophils and monocytes at 1–10 μM. Researchers running migration assays or cytokine release studies should see dose-dependent responses matching published data for authentic LL-37. Counterfeit peptides show no activity or inconsistent results that don't replicate across trials. At Real Peptides, we've seen research teams waste months on failed experiments before discovering their LL-37 source was supplying inactive material.

LL-37 Real vs Fake: Testing Comparison

Verification Method Authentic LL-37 Counterfeit LL-37 Professional Assessment
Third-Party COA HPLC purity ≥98%, MS confirms 4493.3 Da, endotoxin <0.1 EU/mg No independent testing, or in-house results only, or missing data COA from accredited labs (ISO 17025) is non-negotiable. In-house testing cannot be verified
Reconstitution Behavior Dissolves completely in 60–90 seconds, clear solution, pH 6.5–7.5 Cloudiness, precipitate, incomplete dissolution, or off-pH Reconstitution issues indicate contamination or incorrect formulation. Discard immediately
Antimicrobial Activity MIC 2–10 μg/mL against E. coli, S. aureus, dose-dependent response No activity, inconsistent results, or activity only at 100× expected concentration Functional testing is the ultimate proof. Fake peptides fail standard bioassays
Packaging & Labeling Sterile vial, inert gas seal, batch number, exact mass stated, storage temp listed Vague labeling, no batch traceability, non-sterile packaging, missing storage instructions Professional suppliers provide full traceability. Absence of batch data is a red flag
Mass Spectrometry Single peak at 4493.3 Da ±2 Da Off-target mass (4450–4550 Da range), multiple peaks, or no MS data provided MS is the gold standard for peptide identity. Deviations mean it's not LL-37

What If: LL-37 Verification Scenarios

What If My LL-37 Vial Doesn't Dissolve Completely After Reconstitution?

Discard the vial immediately and contact your supplier for replacement with documented testing. Incomplete dissolution indicates contamination, incorrect formulation, or degraded peptide. None of which can be corrected. Cloudiness or precipitate means the product is not suitable for research use, regardless of what the label claims. Real suppliers replace defective batches without question when reconstitution fails.

What If the COA Shows 95% Purity Instead of 98%?

Whether to use 95% purity LL-37 depends on your application. For antimicrobial screening or preliminary dose-response studies, 95% may be acceptable if contaminants are identified (typically truncated sequences or synthesis byproducts that don't interfere with activity). For mechanistic studies, receptor binding assays, or in vivo work, ≥98% purity is required because the 2–5% impurity introduces uncontrolled variables. Request a detailed impurity profile from the supplier. If they can't provide it, the batch is unreliable.

What If I Suspect My LL-37 Is Fake But Can't Afford Mass Spectrometry Testing?

Run a functional bioassay as a first-pass screen. Standard antimicrobial testing against E. coli ATCC 25922 or S. aureus ATCC 29213 costs <$50 in consumables and takes 18–24 hours. Authentic LL-37 shows zone of inhibition in disk diffusion assays or MIC ≤10 μg/mL in broth microdilution. If your peptide shows no activity or requires 100× higher concentration, it's either fake or severely degraded. This doesn't replace MS verification but flags unusable product before you invest in full analytical testing.

What If My Supplier Provides an In-House COA But No Third-Party Testing?

In-house testing is not sufficient for research-grade verification. Suppliers can generate any data they want without independent oversight. The only way to confirm authenticity is third-party analysis from an ISO 17025 accredited lab. Request the name and accreditation number of the testing facility; if the supplier refuses or provides vague answers, find a different source. At Real Peptides, every batch undergoes third-party HPLC, MS, and endotoxin testing with full documentation because unverified claims are worthless in research.

The Blunt Truth About LL-37 Quality Control

Here's the honest answer: most peptide suppliers selling 'research-grade' LL-37 online are reselling bulk powder from overseas manufacturers without any verification beyond the supplier's word. The economics make this inevitable. Synthesizing LL-37 to ≥98% purity costs $800–$1,200 per gram when done correctly (solid-phase peptide synthesis, multiple purification rounds, analytical verification). If you're seeing LL-37 advertised at $200–$300 per gram, it's either low purity, incorrectly synthesized, or outright fake.

The blunt reality is that counterfeit peptides don't just waste money. They corrupt research. A single study using fake LL-37 produces invalid data that can't be replicated, consumes lab time and reagents, and potentially leads to false conclusions published in literature. We've worked with research teams who spent six months troubleshooting failed experiments before discovering their peptide source was shipping inactive material. The cost isn't the $300 vial. It's the $50,000 in wasted salary, consumables, and opportunity cost.

Verification isn't optional for serious research. If your supplier can't provide third-party COAs with batch-specific HPLC, MS, and endotoxin data, you're gambling with your project timeline. Small-batch synthesis with exact amino-acid sequencing and full analytical documentation is the only reliable path to authentic LL-37. Learn about research-grade standards across our full peptide collection and see how precision synthesis ensures every vial matches specification.

Authentic LL-37 costs more upfront but delivers valid data. Fake peptides cost less initially and waste everything downstream. If the price seems too good, it probably is. The peptide verification process isn't there to create barriers; it exists because research depends on knowing exactly what molecule you're working with. One contaminated batch can invalidate months of work, and no discount justifies that risk.

Questions

Visual and reconstitution checks provide initial screening but cannot replace analytical testing. Authentic LL-37 arrives as white lyophilized powder in sterile vials sealed under inert gas, with clear labeling showing exact mass, batch number, and storage conditions. After reconstitution with sterile water, real LL-37 dissolves completely within 90 seconds forming a clear solution — cloudiness or precipitate indicates problems. However, definitive verification requires third-party COA showing HPLC purity ≥98% and mass spectrometry confirming 4493.3 Da molecular weight.
Research-grade LL-37 requires HPLC purity ≥98% for most applications. This threshold ensures that impurities (truncated sequences, synthesis byproducts, degradation products) remain below 2%, minimizing interference with experimental results. Peptides showing 95–97% purity may be acceptable for preliminary antimicrobial screening but are unsuitable for mechanistic studies, receptor binding assays, or in vivo work where the 3–5% impurity introduces uncontrolled variables that corrupt dose-response relationships.
Counterfeit LL-37 containing bacterial endotoxins can trigger inflammatory responses independent of the peptide’s intended mechanism, corrupting immune cell studies entirely. Research-grade LL-37 must test <0.1 EU/mg endotoxin via LAL assay — fake batches often exceed 1–10 EU/mg because manufacturers skip sterility steps during synthesis. This contamination activates TLR4 signaling in monocytes and macrophages, inducing cytokine release that confounds interpretation of LL-37's actual immunomodulatory effects.
Reconstituted LL-37 maintains structural integrity and antimicrobial activity for 7–10 days when stored at 2–8°C or up to six months at −20°C in single-use aliquots. Repeated freeze-thaw cycles degrade the peptide by causing aggregation and oxidation of methionine residues — aliquot stock solutions immediately after reconstitution to avoid this. Authentic LL-37 stored properly shows <5% loss of antimicrobial activity over this timeframe; degraded or fake peptides lose activity within days even under correct storage.
Authentic LL-37 (human cathelicidin antimicrobial peptide) produces a mass spectrometry reading of 4493.3 Da ±2 Da. Results outside this range indicate incorrect synthesis, truncated sequences, or substituted amino acids — meaning the peptide is not LL-37. ESI or MALDI-TOF mass spec detects even single amino acid substitutions (±100–150 Da shifts) and identifies dimerization (mass doubles to ~9000 Da). Counterfeit suppliers often provide peptides reading 4450–4550 Da and market them as LL-37 despite molecular mismatch.
No — in-house testing lacks independent oversight and cannot be verified. Research-grade peptides require third-party Certificates of Analysis from ISO 17025 accredited laboratories conducting HPLC, mass spectrometry, and endotoxin testing on each batch. Suppliers can generate any in-house data without accountability; only independent lab verification provides traceable confirmation of purity, molecular identity, and sterility. Always request the testing lab’s name and accreditation number before accepting COA documentation.
Counterfeit LL-37 frequently contains truncated peptide sequences (missing 1–5 amino acids from incomplete synthesis), bacterial endotoxins from non-sterile production, and filler excipients like mannitol or glycine added to increase mass. HPLC analysis of fake batches shows multiple peaks indicating impurity mixtures rather than the single sharp peak characteristic of pure LL-37. Some counterfeit products contain completely unrelated peptides or zero active compound — pure filler marketed as LL-37 based on labeling alone.
Legitimate research-grade LL-37 synthesized to ≥98% purity with full third-party analytical verification costs $0.80–$1.20 per milligram when purchased in 1–5mg quantities. Solid-phase peptide synthesis, multiple HPLC purification rounds, and comprehensive testing (HPLC, MS, endotoxin assay) create inherent production costs suppliers cannot undercut without sacrificing quality. Peptides advertised at $0.20–$0.40 per milligram typically indicate low purity, incorrect synthesis, or absence of verification — the discount comes from removing quality control steps essential for research use.
Functional bioassays confirm biological activity but do not verify molecular identity — both tests serve different purposes. A peptide might show antimicrobial activity against *E. coli* or *S. aureus* while still being an incorrect analog or degraded LL-37 with altered sequence. Mass spectrometry is the only method that definitively confirms you have the exact 37-amino-acid cathelicidin peptide with correct molecular weight (4493.3 Da). Use antimicrobial testing as a functional screen but never as a substitute for MS verification in research-grade applications.
Find a different supplier immediately — refusal to provide third-party analytical testing is a red flag indicating the product cannot pass independent verification. Research-grade peptide suppliers maintain relationships with accredited testing labs and provide batch-specific COAs as standard practice. Suppliers claiming ‘proprietary testing’ or offering only in-house results lack accountability and should not be used for serious research. At Real Peptides, every batch includes third-party HPLC, MS, and endotoxin documentation because unverified peptides have no place in quality-controlled studies.

RESEARCH USE ONLY · NOT EVALUATED BY THE FDA

Shop Now